missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syntrophin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17941-25UL
This item is not returnable.
View return policy
Description
Syntrophin Polyclonal antibody specifically detects Syntrophin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Syntrophin | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| 59 kDa dystrophin-associated protein A1 acidic component 1, dJ1187J4.5, LQT12, Pro-TGF-alpha cytoplasmic domain-interacting protein 1, SNT1alpha-1-syntrophin, syntrophin, alpha 1 (dystrophin-associated protein A1, 59kD, acidic component), syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component), syntrophin-1, TACIP1acidic alpha 1 syntrophin | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6640 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction