missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Syntrophin gamma 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Syntrophin gamma 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18389125
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18389125 25 μg 25µL
18373832 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18389125 Leverantör Novus Biologicals Leverantörsnummer NBP31744125UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

Syntrophin gamma 2 Polyclonal antibody specifically detects Syntrophin gamma 2 in Human samples. It is validated for Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen Syntrophin gamma 2
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias G2SYNgamma2-syntrophin, gamma-2-syntrophin, MGC133174, SYN5syntrophin 5, syntrophin, gamma 2, syntrophin-5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54221
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.