missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syntaxin-BP1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33541-20ul
This item is not returnable.
View return policy
Description
Syntaxin-BP1 Monoclonal antibody specifically detects Syntaxin-BP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| Syntaxin-BP1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EIEE4, FLJ37475, hUNC18, MUNC18-1, N-Sec1, NSEC1, P67, Protein unc-18 homolog 1, Protein unc-18 homolog A, RBSEC1, syntaxin binding protein 1, syntaxin-binding protein 1, Unc18-1, unc-18A, UNC18A, UNC18neuronal SEC1 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Syntaxin-BP1 (P61764).,, Sequence:, STYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYP | |
| 20 μL | |
| Phospho Specific | |
| 6812 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction