missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syntaxin Binding Protein 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92470
This item is not returnable.
View return policy
Description
Syntaxin Binding Protein 4 Polyclonal antibody specifically detects Syntaxin Binding Protein 4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Syntaxin Binding Protein 4 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| FLJ16496, MGC50337, STX4-interacting protein, SynipMGC149829, syntaxin 4 interacting protein, Syntaxin 4-interacting protein, syntaxin binding protein 4, syntaxin-binding protein 4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALHSRIHLA | |
| 0.1 mL | |
| Endocrinology, Signal Transduction | |
| 252983 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction