Syntaxin Binding Protein 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-92470-25ul

Product Code. 18403421

Description

Syntaxin Binding Protein 4 Polyclonal antibody specifically detects Syntaxin Binding Protein 4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Syntaxin Binding Protein 4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: FLJ16496, MGC50337, STX4-interacting protein, SynipMGC149829, syntaxin 4 interacting protein, Syntaxin 4-interacting protein, syntaxin binding protein 4, syntaxin-binding protein 4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALHSRIHLA
• Quantity: 25 μL
• Research Discipline: Endocrinology, Signal Transduction
• Gene ID (Entrez): 252983
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified