missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syntaxin 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Syntaxin 4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Syntaxin 4 Polyclonal specifically detects Syntaxin 4 in Human samples. It is validated for Western Blot.Specifications
| Syntaxin 4 | |
| Polyclonal | |
| Rabbit | |
| Q12846 | |
| 6810 | |
| Synthetic peptides corresponding to STX4 (syntaxin 4) The peptide sequence was selected from the C terminal of STX4. Peptide sequence VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Renal carcinoma antigen NY-REN-31, STX4Ap35-2, syntaxin 4, syntaxin 4A (placental), syntaxin-4 | |
| STX4 | |
| IgG | |
| 34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title