missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Syntaphilin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35237-20ul
This item is not returnable.
View return policy
Description
Syntaphilin Polyclonal antibody specifically detects Syntaphilin in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Syntaphilin | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| bA314N13.5, KIAA0374, MGC46096, syntaphilin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 300-425 of human Syntaphilin (NP_055538.2).,, Sequence:, MEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRHY | |
| 20 μL | |
| Neuroscience | |
| 9751 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction