missing translation for 'onlineSavingsMsg'
Learn More

Syndecan-2/CD362 Antibody, Novus Biologicals™

Product Code. 18373889 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373889 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18373889 Supplier Novus Biologicals Supplier No. H00006383B04P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

Syndecan-2/CD362 Polyclonal antibody specifically detects Syndecan-2/CD362 in Human samples. It is validated for Western Blot, Flow Cytometry
TRUSTED_SUSTAINABILITY

Specifications

Antigen Syndecan-2/CD362
Applications Western Blot, Flow Cytometry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_002989.2
Gene Alias CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2
Host Species Mouse
Immunogen SDC2 (NP_002989.2, 19 a.a. - 201 a.a.) full-length human protein. ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
Purification Method Protein G purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Extracellular Matrix
Primary or Secondary Primary
Gene ID (Entrez) 6383
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.