SYAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56625

Artikelnummer. 18217951

Beschreibung

SYAP1 Polyclonal specifically detects SYAP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spezifikation

• Antigen: SYAP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp686K221, FLJ14495, FLJ44185, PRO3113, SAP47 homolog, synapse associated protein 1, synapse associated protein 1, SAP47 homolog, synapse-associated protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 94056
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SYAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATKKITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTND
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only