SWSAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-30909-25ul

Product Code. 18420342

Description

SWSAP1 Polyclonal specifically detects SWSAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SWSAP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q6NVH7
• Gene Symbols: SWSAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATPase SWSAP1, C19orf39, Chromosome 19 Open Reading Frame 39, SWIM-Type Containing 7 Associated Protein 1, SWIM-Type Zinc Finger 7 Associated Protein 1, SWIM-Type Zinc Finger 7-Associated Protein 1, SWS1AP1, SWS1-Associated Protein 1, Zinc Finger, Zinc Finger, SWIM-Type Containing 7 Associated Protein 1, ZSWIM7AP1, ZSWIM7-Associated Protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126074
• Target Species: Human
• Isotype: IgG

For Research Use Only