missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SWSAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30909
This item is not returnable.
View return policy
Description
SWSAP1 Polyclonal specifically detects SWSAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SWSAP1 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q6NVH7 | |
| SWSAP1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ATPase SWSAP1, C19orf39, Chromosome 19 Open Reading Frame 39, SWIM-Type Containing 7 Associated Protein 1, SWIM-Type Zinc Finger 7 Associated Protein 1, SWIM-Type Zinc Finger 7-Associated Protein 1, SWS1AP1, SWS1-Associated Protein 1, Zinc Finger, Zinc Finger, SWIM-Type Containing 7 Associated Protein 1, ZSWIM7AP1, ZSWIM7-Associated Protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 126074 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction