missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SVOP Polyclonal antibody specifically detects SVOP in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | SVOP |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | DKFZp761H039, SV2 related protein homolog (rat), SV2-related protein, synaptic vesicle 2-related protein |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SVOP (NP_061181.1). MEEDLFQLRQLPVVKFRRTGESARSEDDTASGEHEVQIEGVHVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?