missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SV2B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | SV2B |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18443341
|
Novus Biologicals
NBP1-92462-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18041717
|
Novus Biologicals
NBP1-92462 |
0.1 mL |
£484.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SV2B Polyclonal specifically detects SV2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SV2B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9899 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ30413, FLJ42732, KIAA0735HsT19680, synaptic vesicle glycoprotein 2B, synaptic vesicle protein 2B homolog | |
| SV2B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title