missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SUV420H2 Polyclonal antibody specifically detects SUV420H2 in Human, Mouse samples. It is validated for Western Blot, Gene Knock-Out
Specifications
Specifications
| Antigen | SUV420H2 |
| Applications | Western Blot, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Knockout Validated |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | EC 2.1.1.43, FLJ98627, histone-lysine N-methyltransferase SUV420H2, KMT5Csuv4-20h2, Lysine N-methyltransferase 5C, MGC2705, Su(var)4-20 homolog 2, Suppressor of variegation 4-20 homolog 2, suppressor of variegation 4-20 homolog 2 (Drosophila), Suv4-20h2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2). FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?