missing translation for 'onlineSavingsMsg'
Learn More

SUV3L1 Antibody, Novus Biologicals™

Product Code. 18426200 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18426200 25 μL 25µL
18446390 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18426200 Supplier Novus Biologicals Supplier No. NBP18071125ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SUV3L1 Polyclonal antibody specifically detects SUV3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SUV3L1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Accession No. Q8IYB8
Gene Alias ATP-dependent RNA helicase SUPV3L1, mitochondrial, EC 3.6.1, EC 3.6.4.13, suppressor of var1 (S.cerevisiae) 3-like 1, Suppressor of var1 3-like protein 1, suppressor of var1, 3-like 1 (S. cerevisiae), SUV3-like protein 1, SUV3suppressor of var1, 3-like 1(SUV3)
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVH
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6832
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.