SUSD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69242

Product Code. 18285134

Description

SUSD3 Polyclonal specifically detects SUSD3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SUSD3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC26847, sushi domain containing 3, sushi domain-containing protein 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 27 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Pig: 77%; Bovine: 77%.
• Target Species: Human, Pig, Bovine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96L08
• Gene Symbols: SUSD3
• Immunogen: Synthetic peptides corresponding to SUSD3(sushi domain containing 3) The peptide sequence was selected from the N terminal of SUSD3. Peptide sequence LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 203328
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only