missing translation for 'onlineSavingsMsg'
Learn More

SUPT5H Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

£161.00 - £383.00

Specifications

Antigen	SUPT5H
Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
30231486 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-33195-20ul	20 μL	£161.00 20µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

30231324 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP3-33195-100ul	100 μL	£383.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

SUPT5H Monoclonal antibody specifically detects SUPT5H in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

Antigen	SUPT5H
Applications	ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human, Mouse, Rat
Gene Alias	DRB sensitivity-inducing factor 160 kDa subunit, DRB sensitivity-inducing factor large subunit, DSIF large subunit, DSIF p160, FLJ34157, SPT5hSPT5, SPT5HTat-cotransactivator 1 protein, suppressor of Ty (S.cerevisiae) 5 homolog, suppressor of Ty 5 homolog (S. cerevisiae), Tat-CT1, Tat-CT1 protein, transcription elongation factor SPT5
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SUPT5H (O00267).,, Sequence:, PHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Dilution	Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene ID (Entrez)	6829
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

SUPT5H Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents