missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Suppression of Tumorigenicity 7 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £366.00
Specifications
| Antigen | Suppression of Tumorigenicity 7 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18615421
|
Novus Biologicals
NBP2-93421-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18692461
|
Novus Biologicals
NBP2-93421-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Suppression of Tumorigenicity 7 Polyclonal antibody specifically detects Suppression of Tumorigenicity 7 in Human samples. It is validated for Western BlotSpecifications
| Suppression of Tumorigenicity 7 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.3), 50% glycerol | |
| 7982 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| DKFZp762O2113, ETS7q, FAM4A, FAM4A1, family with sequence similarity 4, subfamily A, member 1, HELG, RAY1, SEN4, suppression of tumorigenicity 7 (breast), suppressor of tumorigenicity 7 protein, TSG7 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human ST7 (NP_068708.1). QARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title