missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 11 publications
£234.00 - £460.00
Specifications
| Antigen | SUN1 |
|---|---|
| Dilution | Western Blot Western Blot reactivity reported in scientific literature (PMID: 25210889)., Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation Use in immunoprecipitation reported in scientific literature (PMID: 25210889)., Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18483501
|
Novus Biologicals
NBP1-87396-25ul |
25 μL |
£234.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18799063
|
Novus Biologicals
NBP1-87396 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUN1 Polyclonal specifically detects SUN1 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| SUN1 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| KIAA0810UNC84AFLJ12407, MGC176649, Protein unc-84 homolog A, Sad1 and UNC84 domain containing 1, Sad1 unc-84 domain protein 1, Sad1/unc-84 protein-like 1, SUN domain-containing protein 1, unc-84 homolog A, unc-84 homolog A (C. elegans) | |
| SUN1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot Western Blot reactivity reported in scientific literature (PMID: 25210889)., Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation Use in immunoprecipitation reported in scientific literature (PMID: 25210889)., Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O94901 | |
| 23353 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title