missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SUMO1 Monoclonal antibody specifically detects SUMO1 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ELISA
Specifications
Specifications
| Antigen | SUMO1 |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 3D7 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_001005781 |
| Gene Alias | DAP1, GAP modifying protein 1, GAP-modifying protein 1, GMP1SMT3CSMT3H3OFC10UBL1PIC1, SENP2, sentrin, small ubiquitin-related modifier 1, SMT3, SMT3 homolog 3, SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 1 (yeast), Smt3C, SUMO-1, Ubiquitin-homology domain protein PIC1, ubiquitin-like 1 (sentrin), Ubiquitin-like protein SMT3C, Ubiquitin-like protein UBL1 |
| Host Species | Mouse |
| Immunogen | SUMO1 (NP_001005781.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?