SUMO Activating Enzyme E1 (SAE1) Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13273

Product Code. 18135600

Description

SUMO Activating Enzyme E1 (SAE1) Polyclonal specifically detects SUMO Activating Enzyme E1 (SAE1) in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SUMO Activating Enzyme E1 (SAE1)
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: AOS1activator of SUMO1, FLJ3091, HSPC140, Sua1, SUA1sentrin/SUMO-activating protein AOS1, SUMO-1 activating enzyme E1 N subunit, SUMO1 activating enzyme subunit 1, SUMO-1 activating enzyme subunit 1, SUMO-activating enzyme subunit 1, Ubiquitin-like 1-activating enzyme E1A, ubiquitin-like protein SUMO-1 activating enzyme, UBLE1A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SAE1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD
• Quantity: 0.1 mL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 10055
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only