missing translation for 'onlineSavingsMsg'
Learn More

SUMO Activating Enzyme E1 (SAE1) Antibody, Novus Biologicals™

Código de producto. 18457641 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
0.1 mL
25ul
Tamaño de la unidad:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18457641 25ul 25µL
18044838 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18457641 Proveedor Novus Biologicals N.º de proveedor NBP21327225ul

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Rabbit Polyclonal Antibody

SUMO Activating Enzyme E1 (SAE1) Polyclonal specifically detects SUMO Activating Enzyme E1 (SAE1) in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen SUMO Activating Enzyme E1 (SAE1)
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias AOS1activator of SUMO1, FLJ3091, HSPC140, Sua1, SUA1sentrin/SUMO-activating protein AOS1, SUMO-1 activating enzyme E1 N subunit, SUMO1 activating enzyme subunit 1, SUMO-1 activating enzyme subunit 1, SUMO-activating enzyme subunit 1, Ubiquitin-like 1-activating enzyme E1A, ubiquitin-like protein SUMO-1 activating enzyme, UBLE1A
Gene Symbols SAE1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: NSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALE
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10055
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.