missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SUMO Activating Enzyme E1 (SAE1) Polyclonal specifically detects SUMO Activating Enzyme E1 (SAE1) in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | SUMO Activating Enzyme E1 (SAE1) |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | AOS1activator of SUMO1, FLJ3091, HSPC140, Sua1, SUA1sentrin/SUMO-activating protein AOS1, SUMO-1 activating enzyme E1 N subunit, SUMO1 activating enzyme subunit 1, SUMO-1 activating enzyme subunit 1, SUMO-activating enzyme subunit 1, Ubiquitin-like 1-activating enzyme E1A, ubiquitin-like protein SUMO-1 activating enzyme, UBLE1A |
| Gene Symbols | SAE1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?