SULT1A2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93418-0.1ml

Product Code. 18629870

Description

SULT1A2 Polyclonal antibody specifically detects SULT1A2 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: SULT1A2
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: Aryl sulfotransferase 2, arylamine sulfotransferase, EC 2.8.2, EC 2.8.2.1, HAST4, MGC142287, MGC142289, Phenol sulfotransferase 2, phenolic-metabolizing (P) form of PST, phenol-preferring phenol sulfotransferase2, Phenol-sulfating phenol sulfotransferase 2, P-PST 2, ST1A2, STP2P-PST, sulfotransferase 1A2, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 2, thermostable phenol sulfotransferase, TSPST2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-295 of human SULT1A2 (NP_001045.1). KREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
• Quantity: 0.1 mL
• Research Discipline: Cell Biology, Endocrinology, Signal Transduction
• Gene ID (Entrez): 6799
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified