missing translation for 'onlineSavingsMsg'
Learn More

SUG1 Antibody, Novus Biologicals™

Product Code. 18401391 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18401391 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18401391 Supplier Novus Biologicals Supplier No. NBP187372

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SUG1 Polyclonal antibody specifically detects SUG1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SUG1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 to 1:500, Immunocytochemistry/ Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:200 to 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subunit RPT6, Tat-binding protein homolog 10, TBP10, thyroid receptor interactor 1, TRIP1Thyroid hormone receptor-interacting protein 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5705
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.