missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUCLA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | SUCLA2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18229353
|
Novus Biologicals
NBP2-55488 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18619027
|
Novus Biologicals
NBP2-55488-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUCLA2 Polyclonal specifically detects SUCLA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SUCLA2 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8803 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| A-BETA, ATP-specific succinyl-CoA synthetase subunit beta, beta subunit, EC 6.2.1, EC 6.2.1.5, mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta, MTDPS5, Renal carcinoma antigen NY-REN-39, succinate-CoA ligase, ADP-forming, beta subunit, succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial | |
| SUCLA2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title