missing translation for 'onlineSavingsMsg'
Learn More

STYXL1 Antibody, Novus Biologicals™

Product Code. 18369179 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369179 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369179 Supplier Novus Biologicals Supplier No. H00051657B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

STYXL1 Polyclonal antibody specifically detects STYXL1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen STYXL1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_057170.1
Gene Alias dual specificity phosphatase 24 (putative), Dual specificity phosphatase inhibitor MK-STYX, Dual specificity protein phosphatase 24, DUSP24, Map kinase phosphatase-like protein MK-STYX, MKSTYX, MK-STYX, serine/threonine/tyrosine interacting-like 1, serine/threonine/tyrosine-interacting-like protein 1
Host Species Mouse
Immunogen STYXL1 (NP_057170.1, 1 a.a. - 313 a.a.) full-length human protein. MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51657
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.