missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STYXL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | STYXL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
STYXL1 Polyclonal specifically detects STYXL1 in Human samples. It is validated for Western Blot.Specifications
| STYXL1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| dual specificity phosphatase 24 (putative), Dual specificity phosphatase inhibitor MK-STYX, Dual specificity protein phosphatase 24, DUSP24, Map kinase phosphatase-like protein MK-STYX, MKSTYX, MK-STYX, serine/threonine/tyrosine interacting-like 1, serine/threonine/tyrosine-interacting-like protein 1 | |
| STYXL1 | |
| IgG | |
| 36 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_057170 | |
| 51657 | |
| Synthetic peptide directed towards the middle region of human STYXL1The immunogen for this antibody is STYXL1. Peptide sequence FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title