STRIP1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93448-0.1ml

Product Code. 18628280

Description

STRIP1 Polyclonal antibody specifically detects STRIP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: STRIP1
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
• Gene Alias: FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Protein 1
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2). VRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85369
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG