STRA13 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93570-0.02ml

Product Code. 18633390

Description

STRA13 Polyclonal antibody specifically detects STRA13 in Human samples. It is validated for Western Blot

Specifications

• Antigen: STRA13
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: BHLHE40, CENPX, CENP-X, DEC1, FAAP10, FANCM-interacting histone fold protein 2, Fanconi anemia-associated polypeptide of 10 kDa, HLHB2, MGC14480, MHF2centromere protein X, Retinoic acid-inducible gene D9 protein homolog, stimulated by retinoic acid 13, stimulated by retinoic acid 13 homolog (mouse), Stimulated by retinoic acid gene 13 protein homolog
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human STRA13 (NP_659435.2). MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
• Quantity: 0.02 mL
• Research Discipline: Direct Reversal of DNA Damage
• Gene ID (Entrez): 201254
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified