STING/TMEM173 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48684

Product Code. 18677226

Description

STING/TMEM173 Polyclonal antibody specifically detects STING/TMEM173 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: STING/TMEM173
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, hSTING, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, SAVI, Stimulator of interferon genes protein, stimulator of interferon protein, sting, STING-beta, TMEM173, transmembrane protein 173
• Immunogen: This STING/TMEM173 Antibody was developed against a recombinant protein corresponding to amino acids: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY
• Quantity: 0.1 mL
• Research Discipline: Cancer, Immunology, Innate Immunity
• Gene ID (Entrez): 340061
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified