STIL Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93458-0.02ml

Product Code. 18620171

Description

STIL Polyclonal antibody specifically detects STIL in Human samples. It is validated for Western Blot

Specifications

• Antigen: STIL
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: MCPH7, SCL/TAL1 Interrupting Locus, SCL-Interrupting Locus Protein, SIL, TAL1 (SCL) Interrupting Locus, TAL-1-Interrupting Locus Protein
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF
• Quantity: 0.02 mL
• Research Discipline: Cell Biology, Cell Cycle and Replication, Stem Cells
• Gene ID (Entrez): 6491
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified