missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. STEP Antibody, Novus Biologicals™

STEP Antibody, Novus Biologicals™

Product Code. 18421141 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18421141 25 μL 25µL
18492091 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18421141 Supplier Novus Biologicals Supplier No. NBP18718625ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

STEP Polyclonal antibody specifically detects STEP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen STEP
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 3.1.3.48, FLJ14427, Neural-specific protein-tyrosine phosphatase, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched), protein-tyrosine phosphatase striatum-enriched, STEPPTPSTEP, Striatum-enriched protein-tyrosine phosphatase, tyrosine-protein phosphatase non-receptor type 5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGL
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Alzheimers Research, Cancer, Cellular Markers, Hypoxia, Neurodegeneration, Neuroscience, Protein Phosphatase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 84867
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.