missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
STCH Monoclonal antibody specifically detects STCH in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | STCH |
| Applications | Western Blot, ELISA, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 1H8 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_008879 |
| Gene Alias | heat shock 70 kDa protein 13, heat shock protein 70kDa family, member 13, microsomal stress 70 protein ATPase core, Microsomal stress-70 protein ATPase core, STCHStress-70 protein chaperone microsome-associated 60 kDa protein, stress 70 protein chaperone, microsome-associated, 60kD, stress 70 protein chaperone, microsome-associated, 60kDa |
| Host Species | Mouse |
| Immunogen | STCH (NP_008879.3, 375 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?