missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Staufen Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
Staufen Polyclonal antibody specifically detects Staufen in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | Staufen |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 to 0.4 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | double-stranded RNA-binding protein Staufen homolog 1, FLJ25010, RNA binding protein (Drosophila), RNA-binding protein), staufen, RNA binding protein, homolog 1 (Drosophila) |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?