missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STARD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | STARD3 |
|---|---|
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18325302
|
Novus Biologicals
NBP3-17314-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18339445
|
Novus Biologicals
NBP3-17314-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STARD3 Polyclonal antibody specifically detects STARD3 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| STARD3 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Lipid and Metabolism | |
| PBS, pH 7.2, 40% glycerol | |
| 10948 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CAB1, es64, Metastatic lymph node gene 64 protein, metastatic lymph node protein 64, MLN 64, MLN64FLJ41370, Protein CAB1, StARD3, StAR-related lipid transfer (START) domain containing 3, stAR-related lipid transfer protein 3, START domain containing 3, START domain-containing protein 3, steroidogenic acute regulatory protein related | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: EVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title