STAC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17627-100UL

Product Code. 18340912

Description

STAC2 Polyclonal antibody specifically detects STAC2 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: STAC2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: 24b2/STAC2, MGC129694, SH3 and cysteine rich domain 2,24b2, SH3 and cysteine-rich domain-containing protein 2, Src homology 3 and cysteine-rich domain-containing protein 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEP
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 342667
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG