STAC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18410441	Novus Biologicals NBP1-80717-25ul	25ul
18258865	Novus Biologicals NBP1-80717	0.1 mL

Description

STAC Polyclonal specifically detects STAC in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STAC
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q99469
• Gene ID (Entrez): 6769
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTY
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ32331, SH3 and cysteine rich domain, SH3 and cysteine-rich domain-containing protein, Src homology 3 and cysteine-rich domain-containing protein, src homology three (SH3) and cysteine rich domain, STAC1
• Gene Symbols: STAC
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only