missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Stabilin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Stabilin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18350576
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18350576 25 μg 25µL
18328543 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18350576 Supplier Novus Biologicals Supplier No. NBP31709225UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Stabilin-2 Polyclonal antibody specifically detects Stabilin-2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Stabilin-2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CD44-like precursor FELL, DKFZP434E0321, FAS1 EGF-like and X-link domain containing adhesion molecule-2, FAS1 EGF-like and X-link domain-containing adhesion molecule 2, fasciclin egf-like, laminin-type egf-like, and link domain-containing scavengerreceptor-2, Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavengerreceptor 2, FEEL2, FEEL-2, FELE-2, FELL, FEX2, HAREFELL2, hepatic hyaluronan clearance receptor, Hyaluronan receptor for endocytosis, hyaluronic acid receptor for endocytosis, STAB-2, stabilin 2, stabilin-2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KGYVGDGLTCYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLH
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55576
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.