ST8SIA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-30493-25ul

Product Code. 18482122

Description

ST8SIA5 Polyclonal specifically detects ST8SIA5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ST8SIA5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: O15466
• Gene Symbols: ST8SIA5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RYFEFYEGPFEYNSTRCLELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLS
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alpha-2,8-sialyltransferase 8E, EC 2.4.99.-, MGC119670, Sialyltransferase 8E, sialyltransferase 8E (alpha-2, 8-polysialytransferase), Sialytransferase St8Sia V, SIAT8-E, SIAT8EMGC119671, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5, ST8SiaV
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29906
• Target Species: Human
• Isotype: IgG

For Research Use Only