missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17939-100UL
This item is not returnable.
View return policy
Description
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Polyclonal antibody specifically detects ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 in Human samples. It is validated for Immunofluorescence
Specifications
| ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI | |
| 100 μg | |
| Neuroscience | |
| 8128 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction