missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69280
This item is not returnable.
View return policy
Description
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Neuroscience | |
| 8128 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q92186 | |
| ST8SIA2 | |
| Synthetic peptides corresponding to ST8SIA2(ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST8SIA2. Peptide sequence TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction