missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST6GALNAC4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93510-0.02ml
This item is not returnable.
View return policy
Description
ST6GALNAC4 Polyclonal antibody specifically detects ST6GALNAC4 in Human, Mouse samples. It is validated for Western Blot
Specifications
| ST6GALNAC4 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| EC 2.4.99, EC 2.4.99.7, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase IV, Sialyltransferase 3C, Sialyltransferase 7D, sialyltransferase 7D((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase), SIAT3-C, SIAT3C6-sialyltransferasealpha2,6-sialyltransferase, SIAT7-D, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 4, ST6GalNAc IV, ST6GalNAcIV | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1). TLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSF | |
| 0.02 mL | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 27090 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction