missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-69618
This item is not returnable.
View return policy
Description
ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Polyclonal specifically detects ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 in Human samples. It is validated for Western Blot.
Specifications
| ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase E, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase V, GD1 alpha synthase, MGC3184, sialyltransferase 7 (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase) E, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) E, Sialyltransferase 7E, SIAT7-E, SIAT7Ealpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase V, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 5, ST6 neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 5, ST6GalNAc V, ST6GalNAcValpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 | |
| Rabbit | |
| 38 kDa | |
| 100 μL | |
| Epitope Tags | |
| 81849 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9BVH7 | |
| ST6GALNAC5 | |
| Synthetic peptides corresponding to ST6GALNAC5(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 5) The peptide sequence was selected from the middle region of ST6GALNAC5. Peptide sequence AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV The peptide sequence for this immunogen was taken from within the described region. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction