missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49632
This item is not returnable.
View return policy
Description
ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Polyclonal antibody specifically detects ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase E, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase V, GD1 alpha synthase, MGC3184, sialyltransferase 7 (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase) E, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) E, Sialyltransferase 7E, SIAT7-E, SIAT7Ealpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase V, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 5, ST6 neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 5, ST6GalNAc V, ST6GalNAcValpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GYGRDVGNRTSLRVIAHSSIQRILRNRHDLLNVSQGTVFIFWGPSSYMRRDGKGQVYNNLHLLSQVLP | |
| 0.1 mL | |
| Epitope Tags | |
| 81849 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction