missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18387158

ST3GAL5 Antibody (8B4), Novus Biologicals™

Product Code. 18387158 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387158 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18387158 Supplier Novus Biologicals Supplier No. H00008869M04100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ST3GAL5 Monoclonal antibody specifically detects ST3GAL5 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ST3GAL5
Applications Western Blot, ELISA
Classification Monoclonal
Clone 8B4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003887
Gene Alias alpha 2,3-sialyltransferase V, CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, EC 2.4.99.9, Ganglioside GM3 synthase, GM3 synthase, lactosylceramide alpha-2,3-sialyltransferase, Sialyltransferase 9, sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase, GM3 synthase), SIATGM3S, ST3 beta-galactoside alpha-2,3-sialyltransferase 5, ST3Gal V, ST3GALV, ST3GalVSIAT9SATI
Host Species Mouse
Immunogen ST3GAL5 (NP_003887, 31 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQT
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8869
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.