missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSX8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SSX8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SSX8 Polyclonal specifically detects SSX8 in Human samples. It is validated for Western Blot.Specifications
| SSX8 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 280659 | |
| Synthetic peptide directed towards the C terminal of human SSX8The immunogen for this antibody is SSX8. Peptide sequence MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| synovial sarcoma, X breakpoint 8 | |
| SSX8 | |
| IgG | |
| 17 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title