missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSX6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SSX6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SSX6 Polyclonal specifically detects SSX6 in Human samples. It is validated for Western Blot.Specifications
| SSX6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 280657 | |
| Synthetic peptide directed towards the middle region of human SSX6. Peptide sequence IPKIMPEKPAEEGSDSKGVPEASGPQNDGKKLCPPGKASSSEKIHERSGP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dJ54B20.1, psiSSX2, SSXP2, synovial sarcoma, X breakpoint 6 (pseudogene) | |
| SSX6 | |
| IgG | |
| 22 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title