missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SSX4 Monoclonal antibody specifically detects SSX4 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | SSX4 |
| Applications | Western Blot, ELISA, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 3E10 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_005627 |
| Gene Alias | Cancer/testis antigen 5.4, CT5.4SSX4B, MGC119056, MGC12411, protein SSX4, SSX4A, synovial sarcoma, X breakpoint 4 |
| Host Species | Mouse |
| Immunogen | SSX4 (NP_005627, 91 a.a. - 188 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE |
| Show More |
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?