missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSR3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94450-0.1ml
This item is not returnable.
View return policy
Description
SSR3 Polyclonal antibody specifically detects SSR3 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SSR3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| signal sequence receptor, gamma (translocon-associated protein gamma), SSR gamma, SSR-gamma, translocon-associated protein gamma subunit, translocon-associated protein subunit gamma, TRAP-complex gamma subunit, TRAP-gamma, TRAPGSignal sequence receptor subunit gamma | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 70-145 of human SSR3 (NP_009038.1). TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLF | |
| 0.1 mL | |
| Neuroscience, Signal Transduction | |
| 6747 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction